PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG013358.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 395aa    MW: 44195.3 Da    PI: 5.261
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG013358.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W++ +   g++R++k+c++rw +yl
      CCG013358.1 15 KGPWTPEEDQKLIDYIQKHGHGSWRALPMLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding56.37.6e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+++++d ++ lG++ W++Ia++++ gRt++++k++w+++l
      CCG013358.1  68 RGNFSEEEQQIIIDFHQVLGNK-WSAIAQHLP-GRTDNEIKNFWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3231062IPR017930Myb domain
SuperFamilySSF466896.36E-3213109IPR009057Homeodomain-like
SMARTSM007179.1E-161464IPR001005SANT/Myb domain
PfamPF002491.7E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-251669IPR009057Homeodomain-like
CDDcd001671.77E-121762No hitNo description
PROSITE profilePS5129426.59663117IPR017930Myb domain
SMARTSM007177.3E-1767115IPR001005SANT/Myb domain
PfamPF002493.1E-1668113IPR001005SANT/Myb domain
CDDcd001679.14E-1370113No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MMAESPFQDE SALKKGPWTP EEDQKLIDYI QKHGHGSWRA LPMLAGLNRC GKSCRLRWTN  60
YLRPDIKRGN FSEEEQQIII DFHQVLGNKW SAIAQHLPGR TDNEIKNFWN THLKKKLLQM  120
GIDPVTHRPR TDLNIIANLP QLLAAAANFS NLMNIPWDNA IKAQVDATKL QLLHNILQVL  180
GNSPPPNMEA LSNLYASRDH QLYEYLRMNS QLEGVRKCGE DGLSSQGINA QAQSNFPNID  240
APQQPFSDHN PIKDSKSRTH NSDQLVSSYA FPTSNTLPKL VSASPECSSA NTINPNDIIS  300
NPSNATATTF EAWRNLMDDG ANDNYWIDII EKIPKACSDE FSASFCSKER NFTSEEEVSS  360
LSSWSDDPEE SLSTTGSTFI TRDVLASESM AQVSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31131175108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2131600.0AC213160.1 Populus trichocarpa clone POP105-D13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011015226.10.0PREDICTED: transcription factor MYB39-like isoform X2
TrEMBLB9IPK40.0B9IPK4_POPTR; Transcription factor MYB101 family protein
STRINGVIT_16s0039g01710.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-89myb domain protein 9